Protein Info for ABZR86_RS17360 in Dyella japonica UNC79MFTsu3.2

Annotation: adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 2 to 128 (127 residues), 168.7 bits, E=7.1e-54
• PF13671: AAA_33
  • amino acids 4 to 136 (133 residues), 32.7 bits, E=1.3e-11
• PF00406: ADK
  • amino acids 5 to 163 (159 residues), 179 bits, E=1e-56
• PF13207: AAA_17
  • amino acids 6 to 138 (133 residues), 107.2 bits, E=1.3e-34

Best Hits

Swiss-Prot: 69% identical to KAD_STRM5: Adenylate kinase (adk) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 69% identity to smt:Smal_3302)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

See A0A1I2JSY7 at UniProt or InterPro

Protein Sequence (194 amino acids)

>ABZR86_RS17360 adenylate kinase (Dyella japonica UNC79MFTsu3.2)
MRLVLLGPPGSGKGTQAARLKVELGVPHISTGDMLRAAVAAGTPTGLKAKAVMDAGKLVS
DDILLAMLEERLSQDDVKNGFILDGYPRNVAQAEALGHLLAKIGQPLDAVVKLDVPDEVI
IGRVEIRFKAEHRKDDDPVVVRDRLKVYAEQTAPVADFFAKRGQLQVVDGVGELDEVTAR
VKRALAQESAAANG