Protein Info for ABZR86_RS17355 in Dyella japonica UNC79MFTsu3.2

Annotation: 6-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00365: PFK" amino acids 14 to 295 (282 residues), 172.2 bits, see alignment E=8.1e-55

Best Hits

Swiss-Prot: 77% identical to PFP_XANCB: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (pfp) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 78% identity to sml:Smlt3887)

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JUA8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>ABZR86_RS17355 6-phosphofructokinase (Dyella japonica UNC79MFTsu3.2)
MKRSSRSSSGRLLYAQSGGVTAVINATAAGVIEAARAKGVQVYAARNGILGALREDLIDT
SKETAAAIAALRHTPGGAFGSCRYKLKSLEANRAEYERLIEVLRAHDIRWFLYNGGNDSA
DTALKISQLGKGMGYDIRCIGVPKTVDNDLAVTDCCPGFGSVAKYTAVSVLEASLDVASM
ADTSTKVFILEVMGRHAGWIAAAAGLAGDSADAPPHLILFPERVFDEAAFLAKVKATVER
VGWCTVVASEGIRNAEGQFLAEAGGRDAFGHAQLGGVAPVLAALVKDKLGYKYHWALPDY
LQRSARHLASKTDADQAYAVGKAAVEYALAGQNAVMPVIVRSADAPYRWKIESAPLSKIA
NREKKMPASFLTRDGFGITAAARRYLAPLIQGEAPLPYGKDGLPKYVQLKNLAVARQLPA
FKP