Protein Info for ABZR86_RS17350 in Dyella japonica UNC79MFTsu3.2

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 23 to 219 (197 residues), 113.3 bits, see alignment E=1.3e-36 PF03358: FMN_red" amino acids 25 to 125 (101 residues), 27.2 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 39% identical to AZOR2_IDILO: FMN-dependent NADH-azoreductase 2 (azoR2) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 64% identity to vpe:Varpa_3168)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JU21 at UniProt or InterPro

Protein Sequence (239 amino acids)

>ABZR86_RS17350 NAD(P)H-dependent oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MRTSMTTLLHLDASARGGRSDLHAHGSHTRRLSARFAARWRAARAGDVVRYRDLGQRPPA
PVDGDWIHAAFTPEPARLPWMHQRLAESDALIDELIGADLIVAGVPMYNFGVPSGFKAYI
DNIVRVGRSFGFDRARAGEPYWPLLDERPRTLVLLGSRGDYGYGPGGRIEAMNHVEPAVR
TAFGYIGITDVRCVAVEYDEFGGERLAASLHAAEAAVDALADTLLAEHALRAGQAPVTA