Protein Info for ABZR86_RS17210 in Dyella japonica UNC79MFTsu3.2

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 21 to 437 (417 residues), 354 bits, see alignment E=5.9e-110 PF02321: OEP" amino acids 24 to 210 (187 residues), 91 bits, see alignment E=4.2e-30 amino acids 234 to 423 (190 residues), 125.8 bits, see alignment E=9.3e-41

Best Hits

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HRJ0 at UniProt or InterPro

Protein Sequence (438 amino acids)

>ABZR86_RS17210 TolC family outer membrane protein (Dyella japonica UNC79MFTsu3.2)
MRLKLLTLALALTALPLSGHSEDLLDAYREARANDPVLAQSDATRLSTGEGVTQARALLL
PQLNAGLTFNQYSGNNSQDIAGGHSRARTESATLSQSVLDLSKWAGLKTARSQSDAQDQL
YQAALQNLYVRVTQAYFGVLTAQDSLTFNKANEEAYRQSYEQADQRFKVGLAAITDVYQA
KSYYELAKAQTIAAENTLNDSKEALRQITGQPVGELKKLRDDLPMDAPSPADPNTWVDEA
LKHNPNVLSQQYTVEAAEHNISAARAGHLPTINATVTRGETTAWTENGGVGIPGNGRYGT
TAGLTLSVPIFAGGGTQSRVRQSIYDRDSAQDSLESTRRQVSRDTLNYYRSVGAGILQVQ
ANRASVESGQKALEATRAGFDVGTQTMLNVLNAIQTLTQAQSSYSQARHTFILNKLQLKQ
AAGTIDMPDLEAVNSLLQ