Protein Info for ABZR86_RS17170 in Dyella japonica UNC79MFTsu3.2

Annotation: Yip1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 38 to 65 (28 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 111 to 127 (17 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 193 (28 residues), see Phobius details PF04893: Yip1" amino acids 12 to 181 (170 residues), 70.7 bits, see alignment E=7e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HTJ7 at UniProt or InterPro

Protein Sequence (416 amino acids)

>ABZR86_RS17170 Yip1 family protein (Dyella japonica UNC79MFTsu3.2)
MDFAKIIARARAILTTPKTEWPVVAAEPATVQGIYTNYILVLAAVPAIAGFIKNSLIGIS
LLSVTWRAPVGSGLAGMVLQYLLSLVLVYVMSLIINALAPTFGGQKDPVQALKAITYACT
ASWVAGAANILPWIGWLIALAGGIYSIYLLYLGLPATMKNPVEKSAGYTAVTIVIGAVLG
WIVGMIVAGVVGTAALTGAAMNNGHVTLNGDHGSVTVDPDSAAAKLAAMGARAEQASKEL
EAAQKSGDTAAQQAAMGKMMGNDGSVQSLSADQIKTFLPDTAAGLKRESLSAERSAGVGV
QITVARGQYGDGTRNVELEISDTGSMKGMMAVANAFAAESEQQTDDGYEKTYSKDGRLVH
ESWDKTSKSGEYTVVVGQRFSVKASGQAEIDQLKDAVDSVDLAKLESLKNEGVGKN