Protein Info for ABZR86_RS17095 in Dyella japonica UNC79MFTsu3.2

Annotation: protein-disulfide reductase DsbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 730 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 337 to 361 (25 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 415 to 438 (24 residues), see Phobius details amino acids 458 to 484 (27 residues), see Phobius details amino acids 491 to 512 (22 residues), see Phobius details amino acids 532 to 549 (18 residues), see Phobius details amino acids 556 to 574 (19 residues), see Phobius details amino acids 586 to 603 (18 residues), see Phobius details PF11412: DsbD_N" amino acids 37 to 153 (117 residues), 100.9 bits, see alignment E=7.4e-33 amino acids 191 to 307 (117 residues), 105.9 bits, see alignment E=2.1e-34 PF02683: DsbD" amino acids 345 to 514 (170 residues), 33.2 bits, see alignment E=7.5e-12 PF13899: Thioredoxin_7" amino acids 623 to 703 (81 residues), 58.1 bits, see alignment E=1.2e-19

Best Hits

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HVI7 at UniProt or InterPro

Protein Sequence (730 amino acids)

>ABZR86_RS17095 protein-disulfide reductase DsbD (Dyella japonica UNC79MFTsu3.2)
MQPICLNRPTARFIALAWLLLALLLSGISSAWAQDDDNILPVTEAYKLKADASTPGVVKL
HWDIAPDYYLYRGRMKFTGADGVTAGEARLPDGARHHDEYLGDVEIYHHEVDATVPYTVA
PGTQRLKLAVRYQGCHEVEPKICYPPHTEQLDLPLPAGAAQADAAAPQTLGAALAQIGGT
SPSTAAPGTDAAPLPAEQAFRFEALASKPNQLLLRWTMPKGYYLYRDQTSLHLNAAGLKL
GQPQWPQGTVKQDPHFGKVTVYFDQVELPVAIQGDLAGRRQVAIEASFQGCQDGGLCYPL
MTRAVDVDLAGGTTAVGQAAAGPAPETRPAAELEVSLWAALLLALGGGLVLNLMPCVLPV
LSIKAVGLIESGESPAHRRRHALAYTAGVLVSFVVLGLVILSLKAAWGAQLQRPLVVAAL
SLVMLAVALSMSGVVQFGASLGNAGSGLASRAGLAGDFFTGVLAVVVASPCTAPFMGSAL
AYALAAPTAQAMLVFVMLGLGLALPFLAVGYVPALARLLPRPGAWMETLKQVLAFPMYLA
AVWLAWVLANQRGADAVGLLLVAGVMLAMALWWFERSRYRSAGARSLAVLPLLLGLAPLY
YLAHLPPPVAAASAAEGTVAFTPAKLAELRKAGTPVFVDMTADWCITCKANEHAVLATDA
FRDLLKRTGAVYMKGDWTNEDPDITAFLQQYHTPGVPLYVVFPKHGGDGRKLPTVLTSSL
VEQALTEAAK