Protein Info for ABZR86_RS17080 in Dyella japonica UNC79MFTsu3.2
Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to BCCP_PSEAE: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 67% identity to psu:Psesu_0408)MetaCyc: 58% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII
MetaCyc Pathways
- biotin-carboxyl carrier protein assembly (4/4 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- glyoxylate assimilation (6/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2HSZ4 at UniProt or InterPro
Protein Sequence (152 amino acids)
>ABZR86_RS17080 acetyl-CoA carboxylase biotin carboxyl carrier protein (Dyella japonica UNC79MFTsu3.2) MDLRKIKKLIDLLEESNLAELEIKEGEEVVRLSRVPKGTVNVAAAPVMAPVMQAPAPVAA PAPAAEAAPASTLPAGHVVKAPMVGTFYASATPGAAAFVKVGQQVKAGETLGIIEAMKMF NQIEADVAGTVQAILVDNGQPVEFDQPMFVIA