Protein Info for ABZR86_RS17075 in Dyella japonica UNC79MFTsu3.2

Annotation: four helix bundle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF05635: 23S_rRNA_IVP" amino acids 12 to 114 (103 residues), 124.6 bits, see alignment E=1e-40 TIGR02436: four helix bundle protein" amino acids 16 to 120 (105 residues), 119.1 bits, see alignment E=5e-39

Best Hits

KEGG orthology group: None (inferred from 68% identity to xca:xccb100_0546)

Predicted SEED Role

"23Sr RNA gene"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>ABZR86_RS17075 four helix bundle protein (Dyella japonica UNC79MFTsu3.2)
MVNRESAKRPHEDLTVWQQAMSLVEQVYACSSKFPDSERFGLTAQLRRAAISVPSNIAEG
AARRSTPEYLRFLSIARGSLSELDTQLQIAYRLGYSEFPPEIKTRIDDVFAMLTGLMNAL
QAREATR