Protein Info for ABZR86_RS17065 in Dyella japonica UNC79MFTsu3.2

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 3 to 297 (295 residues), 335.6 bits, E=4.6e-104
• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 3 to 291 (289 residues), 255.9 bits, E=2.7e-80
• PF05175: MTS
  • amino acids 150 to 217 (68 residues), 32.8 bits, E=7.7e-12
• PF13847: Methyltransf_31
  • amino acids 165 to 213 (49 residues), 27.6 bits, 3.5e-10

Best Hits

Swiss-Prot: 61% identical to PRMA_XANAC: Ribosomal protein L11 methyltransferase (prmA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 61% identity to xac:XAC0526)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1I2HRY0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>ABZR86_RS17065 50S ribosomal protein L11 methyltransferase (Dyella japonica UNC79MFTsu3.2)
MPFLELTLTIRSEQQPRVEEALEDIGALSVTLQDADAETPDEQAIFEPGVGELPLWPTIT
LNALFDEHTDRRGLTEALGELLPWLEPDQVQYRDIADQDWERAWMDTFKPMQFGRRLWIY
PWNIEPPADDDAVVVRLDPGLAFGSGTHPTTALCLEWLDAQALQGRSVIDYGCGSGILAI
AALKLGAASAVGVDNDPQALTASADNAERNEVAERLALFLPEDHDVEPADVFVANILAGP
LAELAPTFAAAARPGAPFAISGILKGQEDELLERYAEWFEELRADTREDWVRISGRRRQA