Protein Info for ABZR86_RS16965 in Dyella japonica UNC79MFTsu3.2

Annotation: DNA helicase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 PF00580: UvrD-helicase" amino acids 10 to 277 (268 residues), 272.4 bits, see alignment E=1.6e-84 PF13245: AAA_19" amino acids 14 to 260 (247 residues), 70.4 bits, see alignment E=5.3e-23 PF13361: UvrD_C" amino acids 282 to 634 (353 residues), 287.1 bits, see alignment E=7.3e-89 PF13538: UvrD_C_2" amino acids 574 to 630 (57 residues), 33.5 bits, see alignment 9e-12 PF21196: PcrA_UvrD_tudor" amino acids 694 to 736 (43 residues), 38.9 bits, see alignment 1.9e-13

Best Hits

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HT92 at UniProt or InterPro

Protein Sequence (741 amino acids)

>ABZR86_RS16965 DNA helicase II (Dyella japonica UNC79MFTsu3.2)
MDVSHLIDKLNDAQREAVCAQPGHYLVLAGAGSGKTRVLTHRIGWLTQVLEVPPWAILAV
TFTNKAAGEMRGRLDALIGAGTQGLTVGTFHGIAHRLLRRHWREAGLPEGFQILDADDQQ
RIVKRVVAGLGLDEAKFPPRQATWQINSWKDEGKRPGSIEHRDHPVTRTFVQIYQAYEEA
CQRAGLVDFAELLLRAHELWLKNPAVLEHYQQRWRYLLIDEFQDTNTLQYAWIRVLAGSS
GQAASAQVFVVGDDDQAIYGWRGAKVENVQQFLRDFPGAKTIKLEQNYRSTSTILKAANA
VIARNGSRLGKQLWTDGEDGERIAVYASYNEQDEARYVIERIREYIAEHGDARDCAILYR
SNAQSRNFEEQLIQRDIPYRVYGGLRFFERAEIKDALAYLRLSANRHDDAAFERAVNTPP
RGIGDRTLDALRKRARGEGTSLWEAALNELATGRELAGRAKNAVKAFLQMIEEMARTFSG
KTDGDTEATALALAEQMEHAISHTGLRDFYEKDSRGNAESRVENLDELVNVASRFEPTAE
DIEAGLSELSAFLSHAALEAGEGQGESWDDCVQLMTLHSAKGLEFPVVFLVGMEEGLFPS
QRSVEDEGRLEEERRLAYVGITRARERLVITYAESRRMHGVEMLARPSRFLAEVPPDLVD
EVRPRVQVTRPLYAGRFAESAASSLKEDLPVKLGQRVSHPSFGEGVVVSAEGSGAHTRLQ
INFEAAGSKWLVAAYANLTPL