Protein Info for ABZR86_RS16680 in Dyella japonica UNC79MFTsu3.2

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 67 to 92 (26 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 305 to 332 (28 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 55% identity to pfv:Psefu_3775)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2H5Y6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>ABZR86_RS16680 AI-2E family transporter (Dyella japonica UNC79MFTsu3.2)
METSLPQPRQPSLPIRITTYVLAGAALLLVMLLRLLPALFAGLLVYEIVQSTAPLLGKRV
PGDRARVLVVALLAAIVVGLLILLILGALSFFRTELGNPELLWQDQLMPLVEKARQQLPA
SIVGWLPDSVDELRVMALELTHKHSVSLQSLGKETARVLVHIIIGMVLGGIVALSRTRPA
HQVGPLAAALGLRCQRLAEAFHNIVFAQIKISLINTVFTAIFLLGVMPLMGFHIPLAKTL
VVITFIVGLLPVIGNLISNTAITIAGLSVSLGVGVAALGFLILIHKLEYFLNARIVGTQI
RSRAWELLVAMLVVEAAFGLPGLVAAPIYYAYLKSELEAERLI