Protein Info for ABZR86_RS16445 in Dyella japonica UNC79MFTsu3.2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HD57 at UniProt or InterPro

Protein Sequence (202 amino acids)

>ABZR86_RS16445 hypothetical protein (Dyella japonica UNC79MFTsu3.2)
MESLTRRIAAWPAWGRGLLLSLIMAGYFVVMALMTRLHGTGGRALTLALLVGLTLVLAYV
SRAAACSEAEGEIRREDRRYIAEFVPAMAVYFALMLFVWPLHKTTDATWLRALIALSPAL
PVAAIALSLFRYVTASDEFMQRLHLQALALAAGVVAVVSMAVGFLAAAKVVSLDGSVLLL
VFPGLMLVYGPTLAWAKRRYRD