Protein Info for ABZR86_RS16405 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 105 to 133 (29 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 222 (17 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 10 to 218 (209 residues), 126.3 bits, see alignment E=1.3e-40 PF12698: ABC2_membrane_3" amino acids 59 to 247 (189 residues), 40.8 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 58% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 74% identity to xcv:XCV4153)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HD15 at UniProt or InterPro

Protein Sequence (258 amino acids)

>ABZR86_RS16405 ABC transporter permease (Dyella japonica UNC79MFTsu3.2)
MNASGNLVALGTIVRREIVRILRIWTQTLIPPAITMTLYFVIFGKLIGSRIGTIEGGFSY
MQYIVPGLVMMSIITNSYGNISSSFFGAKFSRAVEEMLVSPMPNWVILLGYVTGAVTRGM
IVGALVLVIALFFTHLQVAHPLITFASVLLGATIFSLAGFVNAVYAKKFDDIALVPTFVL
TPLTYLGGVFYSVNMLAEPWQSISRVNPILYMVNAFRFGVLGVSDVNVAGAFVVMLLFVA
GLSAVALHLLKRGVGLRS