Protein Info for ABZR86_RS16285 in Dyella japonica UNC79MFTsu3.2

Annotation: cell division protein ZapE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF03969: AFG1_ATPase" amino acids 8 to 367 (360 residues), 401.3 bits, see alignment E=1.9e-124

Best Hits

Swiss-Prot: 50% identical to ZAPE_ECO57: Cell division protein ZapE (zapE) from Escherichia coli O157:H7

KEGG orthology group: K06916, (no description) (inferred from 49% identity to maq:Maqu_2697)

Predicted SEED Role

"ATPase, AFG1 family" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HCT1 at UniProt or InterPro

Protein Sequence (372 amino acids)

>ABZR86_RS16285 cell division protein ZapE (Dyella japonica UNC79MFTsu3.2)
MSDTPPIAPSARYHEGVAAHRWESDPAQLAVLPEFDRMHAALIAAREDSGGLFGRLKSLL
GGEARDAVPGLYLWGSVGRGKTFLMDLFVASLPHGIALRRHYHRFMGEVHERLRELGNRQ
DPLLEVADGIAARCRVLCLDEFLVNDIGDAMILGTLLEALFARGVSLVTTSNTQPRNLYK
DGLQRARFLPAIALLEQHCRVVEMISSRDWRLRALTQAPVYFTPPSAEAERSLARIFAAQ
AQGEASEGGAMVINDRPIPVRKRAGNILWFDFDALCEGPRAVADYIAIAKAGPAVIVSNV
PQFSIYSEDAARRFVLLVDEFYDRHVKLILSAAAPITELYDGERLRAEFGRTESRLIEMQ
SEEYLASEHRAD