Protein Info for ABZR86_RS16280 in Dyella japonica UNC79MFTsu3.2

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01891: amidohydrolase" amino acids 38 to 417 (380 residues), 339.9 bits, see alignment E=9.4e-106 PF01546: Peptidase_M20" amino acids 95 to 419 (325 residues), 140.6 bits, see alignment E=6.6e-45 PF07687: M20_dimer" amino acids 217 to 318 (102 residues), 42.2 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: None (inferred from 59% identity to psu:Psesu_0067)

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HCV1 at UniProt or InterPro

Protein Sequence (446 amino acids)

>ABZR86_RS16280 amidohydrolase (Dyella japonica UNC79MFTsu3.2)
MRHALLALSLATAIASAHASEHGVDAAQRIQGALPQVTAWRREIHQHPELSNRETRTAAL
VAAQLKKLGLEVRTGIAHTGVVGILKGGQPGPKLAIRADMDALPVTEEVDLPFASKAQGE
YRGKSTGVMHACGHDTHTAMLLGLATVLAGMRQELSGEVMFLFQPAEEGAPAGEQGGAPL
MLQEGVFRDFAPDAMFAMHVISTLNAGTVAVRPGPALSGADGFKLVVHGRQTHGAMPWHG
VDPIVTAAQIVTQAQTIVSRRLDIGTLPAVLSFGIVEGGARHNIVPDKVELQGTLRTFDP
AMRQQAIDGLRDIAEHVAAANGATVEAQIPMDGSVPVTVNEATLTARVRASLAKAIGGEQ
VLEAPPAMPSEDFAYFARAVPSVYFFVGATPAGQDPAKAPANHSPRFFVDEDALRVGMLS
MLQATLDYLQPPASGSAAIATRPSAG