Protein Info for ABZR86_RS16195 in Dyella japonica UNC79MFTsu3.2

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR03138: queuine synthase" amino acids 4 to 273 (270 residues), 392.5 bits, see alignment E=6.1e-122 PF14819: QueF_N" amino acids 15 to 124 (110 residues), 158.7 bits, see alignment E=6.2e-51 PF14489: QueF" amino acids 187 to 262 (76 residues), 84 bits, see alignment E=7e-28

Best Hits

Swiss-Prot: 66% identical to QUEF_CHRVO: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 66% identity to cvi:CV_3750)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HE22 at UniProt or InterPro

Protein Sequence (273 amino acids)

>ABZR86_RS16195 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (Dyella japonica UNC79MFTsu3.2)
MSTPEHSPLGKTTVYADRYDPSLLFPIPRQSKRDEIGVSAPLPFHGVDIWNAYELSWLDA
RGKPRVALAEFRVPAGSPNIIESKSFKLYLNGFAQERIDDVQALAATLRRDLSAAAGAEV
GVQLSEPSARAHAVVDLDGISIDTLDVAIDDYGPPKAAYLCADVDEVIEETLVSDLLRSN
CPVTGQPDWGSVQIRYRGPRIEREGLLRYLVSFRNHNEFHEQCVERIFVDVTRHCAPLQL
SVYARYTRRGGLDINPFRASAEAVPGNPRGARQ