Protein Info for ABZR86_RS16050 in Dyella japonica UNC79MFTsu3.2

Annotation: SIS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF01380: SIS" amino acids 46 to 167 (122 residues), 64.8 bits, see alignment E=3.5e-22 amino acids 202 to 286 (85 residues), 53.1 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 67% identity to xcv:XCV0770)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16 or 3.5.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JHI1 at UniProt or InterPro

Protein Sequence (344 amino acids)

>ABZR86_RS16050 SIS domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MKQASDTLMYREAHESADVVERQLAANADVLKALGERLRAEPPRFIVTCARGSSDHAAAY
AKYVFETRLGLLTASASPSVASIYDADLKLDGALFLVISQSGKSPDLLRSAQAAKDAGAL
VVAMVNVEDSPLAALADTVIPLRAGPELSVAATKSYLATLAAILQLTAHWGNDDTLHADV
ARLPADLRRGWDADWSALVDGLREARNLFVVGRGYGFGAALEAALKLKETCGLHAEAFSA
AEVKHGPMAIVGAGFPVLFFAQGDDTLDSTLAVAEEFRARGARVLVAKPGASGADALPLP
AGMDSIVTPLLAVQSFYRATSELALARGFDPDVPPHLRKVTETV