Protein Info for ABZR86_RS16045 in Dyella japonica UNC79MFTsu3.2

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00221: N-acetylglucosamine-6-phosphate deacetylase" amino acids 8 to 380 (373 residues), 317.5 bits, see alignment E=5.7e-99 PF01979: Amidohydro_1" amino acids 58 to 381 (324 residues), 81.5 bits, see alignment E=7.2e-27 PF07969: Amidohydro_3" amino acids 330 to 376 (47 residues), 30.3 bits, see alignment 3.3e-11

Best Hits

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 64% identity to smt:Smal_3421)

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JIE9 at UniProt or InterPro

Protein Sequence (386 amino acids)

>ABZR86_RS16045 N-acetylglucosamine-6-phosphate deacetylase (Dyella japonica UNC79MFTsu3.2)
MSAAQPLLALVNGRVLADHGPRNDLAVLVRGGRIEALVPAGDPSLDKATRHDLQGRLLLP
GFIDVQVNGGGGLLFNAAPTVDTLRGIAAAHRRFGTTGMLPTLITDTADVMHAALEAVDA
AIAEGVPGILGIHLEGPFLAPARKGIHDANLFRLPDAADIADIARKHRGVVMMTLAPERV
PLETIRQLSAAGVIVVAGHTAADYATMRAALDAGVSGFTHLYNAMTPLGSRDPGVVGAAL
DDPHSWCGLIVDLHHVHPASLRVAIAAKARGKSVLVTDAMPPVGADDPTYVLNGQTIVAR
DGVCQSDDGVLAGSALDMATGVRHLVNAVGLPLAEASRMASAYPAAWLGLERELGRIVAG
QRADFAVLDDALVVQETWIGGVRYAA