Protein Info for ABZR86_RS16005 in Dyella japonica UNC79MFTsu3.2

Annotation: LTA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details PF00884: Sulfatase" amino acids 222 to 460 (239 residues), 77.2 bits, see alignment E=7.1e-26

Best Hits

Predicted SEED Role

"Capsular polysaccharide biosynthesis protein WcbQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JJA5 at UniProt or InterPro

Protein Sequence (560 amino acids)

>ABZR86_RS16005 LTA synthase family protein (Dyella japonica UNC79MFTsu3.2)
MAWLCASLFFAGCVRATAGQEPVLQQQGFVFALMLCTCGVLLFAFARVAMALVVTGALFL
GLDFISEIKQQYLDAPLMPSDFVYYLRSSLVETLAHYPHLWELAAGVAVLVPLGLWLVWR
GDRRMLGNLSRPKAFAVRVGGAVACALVFWICLLPNGPFAQVHARNAWQKLSDDAQLTNF
FVNLQDSNVALPPMTDDTLAEQEWGATAHGGLGTAQQPYPDIVQVLEESTFDPSNFAVCN
VPQCRVQMFKPDKYTLAHGPLRVHTFGGGTWVSEFAVLTGMPQDIFGPGGMYAPYVLAPH
VRDSLPQQLQRLGYLTVAIYPTNGAFLNGRNAYTAYGFEQFYDAKDLGLEEWEETDAQMF
DAAKRVYDKVKKPGQPVFVMILTLAQHGPHDLDPLSSLPAPFNRPLLKGLAEKPALNFNT
YLSNLHNSDLAMTQLEKAFLDRPEPTVLMHFGDHQPSFDGLIRQMERSWPPALQPYKDYL
SYYMIKSNVPGRSLPNYPMLDIAHLPNMVLQAAGVPMDPYFSAATVLRERCKGLYTDCID
QDLVKSYHGWIFNHLHVYEE