Protein Info for ABZR86_RS15950 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-isopropylmalate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00169: 3-isopropylmalate dehydrogenase
  • amino acids 4 to 344 (341 residues), 485.3 bits, E=5e-150
• PF00180: Iso_dh
  • amino acids 5 to 343 (339 residues), 434.1 bits, E=2.3e-134

Best Hits

Swiss-Prot: 58% identical to LEU3_BACLD: 3-isopropylmalate dehydrogenase (leuB) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 68% identity to sml:Smlt3921)

MetaCyc: 47% identical to 3-(4-hydroxybenzyl)-malate dehydrogenase (Aspergillus rugulosus)
1.1.1.-

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• L-leucine biosynthesis (6/6 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
• 3-hydroxy-L-homotyrosine biosynthesis (1/5 steps found)
• aliphatic glucosinolate biosynthesis, side chain elongation cycle (10/30 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

See A0A1I2JJM7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>ABZR86_RS15950 3-isopropylmalate dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MKARIVTLPGDGVGPEVTAAAVAVLDAVAAHYDHTFDYEQHLIGGCAIDATGEPLPADAL
AACKSADAVLLGAVGGPKWSDPSAPVRPEQGLLALRAALGVYANLRPLQVHPALTALSPL
KDDKLRNVDVLFVRELTGGAYFGAKTRTVDTATDECKYTVVEVERVVRRAFELARGRRHK
VTSVDKANVLETSRLWRSTVQRIAADYPDVKLEHQLVDSMAMLLLTQPASYDVVVTENLF
GDILTDEAAALAGSLGLLPSASLGEGARGLYEPIHGSAPDIAGKGVANPVGAILSAAMLL
RHSLGLEEEAGAVEAAVEHVLEHGPRSRDIGGDAGTAAIREAVVAALDEHVANSEAFFSG
ARACG