Protein Info for ABZR86_RS15935 in Dyella japonica UNC79MFTsu3.2

Annotation: biosynthetic-type acetolactate synthase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00118: acetolactate synthase, large subunit, biosynthetic type
  • amino acids 1 to 580 (580 residues), 649.1 bits, E=2.8e-199
• PF02776: TPP_enzyme_N
  • amino acids 1 to 122 (122 residues), 113.8 bits, E=6.5e-37
• PF00205: TPP_enzyme_M
  • amino acids 211 to 343 (133 residues), 143 bits, E=7.4e-46
• PF02775: TPP_enzyme_C
  • amino acids 407 to 557 (151 residues), 160.5 bits, E=3.9e-51

Best Hits

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 66% identity to hha:Hhal_1594)

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• L-isoleucine biosynthesis II (4/8 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A0A1I2JNJ8 at UniProt or InterPro

Protein Sequence (600 amino acids)

>ABZR86_RS15935 biosynthetic-type acetolactate synthase large subunit (Dyella japonica UNC79MFTsu3.2)
MSGAEVVVQVLADEGVDVLFGYSGGAILPVYDAVFRYNATHIGPSGGEPMPLIVPANEQG
AGFMAAGYARASGKVGVAIVTSGPGATNMVTPVRDSMSDSVPMVVLCGQVPTTAIGSDAF
QEAPIANIMSACAKHVFLVTDAEKLEATLRTAFEIARSGRPGPVVVDIPKDVQNTLLPFH
GEGLLPMPGYRARLQRLEQSTLDDAQCVAFFEALAQSKRPLIYAGGGTIASGASHELRAF
VADYGLPVTTTLMGLGAYDTTEPLALHMLGMHGTAYANYAVEDCDFLFTLGARFDDRVAG
VPDKFAPQAKFIAQIDIDPAEIGKVKSVDWHHTGDLTRTLAQLRAWGERHGWREQLSARY
APWHRHVAELKQVHALDYDRASPLIQPYAVIEEINRHTQGHAVISTGVGQHQMWAAQYFD
FREPRHWLSSGSMGTMGFGLPAAIGAQFARPGAVVIDIDGDASIRMNLGELETVTTYGLP
VKVVVLNNIGDGMVRQWQKLFFRGRFASSDKSLHRKDFIKAAQADGFEWARRLERREELA
ATIADFLAHPGPAFLEVMIDPDAGVYPMVGPGATYAQMITGDHIASRQAVQADGAASDMF