Protein Info for ABZR86_RS15925 in Dyella japonica UNC79MFTsu3.2

Annotation: threonine ammonia-lyase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 186 to 206 (21 residues), see Phobius details TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 17 to 518 (502 residues), 815.4 bits, see alignment E=8.5e-250 PF00291: PALP" amino acids 31 to 322 (292 residues), 275.6 bits, see alignment E=5.3e-86 PF00585: Thr_dehydrat_C" amino acids 335 to 424 (90 residues), 79 bits, see alignment E=2e-26 amino acids 436 to 518 (83 residues), 86.2 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 69% identical to ILVA_BURM1: L-threonine dehydratase biosynthetic IlvA (ilvA) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 70% identity to bxe:Bxe_A4054)

MetaCyc: 56% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JNM5 at UniProt or InterPro

Protein Sequence (523 amino acids)

>ABZR86_RS15925 threonine ammonia-lyase, biosynthetic (Dyella japonica UNC79MFTsu3.2)
MNAVAAHRPPTEEADHDLLRRTLAARVYEVARETALESAPLLSARLGQRVLLKREDQQPV
FSFKLRGAYNKMVGLDAAQRARGVIAASAGNHAQGVALAAAKLGLRAVIVMPVTAPQVKI
DAVRRLGGAWVEVVLAGDSYSDAQAEAARLEQQHGYTFVHPFDDPAVIAGQATVGMEILR
QHPGPLHAVFVPVGGGGLLAGVAAYIKALRPEVKVIGVQTVDSDAMAQSLEQGERVTLDE
VGLFADGTAVKRVGAETFALCQRHVDAMLRVDTDAICAAIRDVFQETRSVPEPSGALALA
GLKQYAATHQLDDATLVAIVSGANLNFDRLRFVAERAEVGEQREAVFAVTIPEERGSFRR
FCATLGQRSITEFNYRIGDAASAHIFVGIQIRQRDEREALTAAFAAEGFGVLDLTDDELA
KLHLRHMIGGRSPLAHDELLYRFEFPERPGALTRFLGHMHPDWNISLFHYRNHGADYGRI
LVGIQVPAGERAMFEQFLAQLGYPCRDESGNPAYRLLLREASP