Protein Info for ABZR86_RS15885 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-oxoacyl-ACP reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00106: adh_short" amino acids 7 to 195 (189 residues), 191.7 bits, see alignment E=2.1e-60 PF01370: Epimerase" amino acids 9 to 146 (138 residues), 26.6 bits, see alignment E=8e-10 PF08659: KR" amino acids 9 to 181 (173 residues), 54.6 bits, see alignment E=2.7e-18 PF13561: adh_short_C2" amino acids 16 to 245 (230 residues), 196.9 bits, see alignment E=8.1e-62

Best Hits

Swiss-Prot: 51% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 67% identity to bcj:BCAL2464)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JAM0 at UniProt or InterPro

Protein Sequence (246 amino acids)

>ABZR86_RS15885 3-oxoacyl-ACP reductase family protein (Dyella japonica UNC79MFTsu3.2)
MSSLDGKVALVTGGSRGIGAAIVRRLARDGATVAFTYVSSPDKAQALVQEIEAAGGKARA
YQADAADTAALQAAVDRVAAESGRLDILVNNAGIFLGGAFEDTTLEDFERTMAVNVRAVF
VASQAAVRHMGDGGRIVSIGSCLADRVPSAGMTLYSMSKSALSAFTRGLARDLGPRGITV
NVVQPGSTDTDMNPADGAHAEEQRGRMAIKRYGDASNIAGMVAWLASEEGRFANGAAFTI
DGGANA