Protein Info for ABZR86_RS15830 in Dyella japonica UNC79MFTsu3.2

Annotation: sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF17773: UPF0176_N" amino acids 4 to 94 (91 residues), 97.7 bits, see alignment E=4.3e-32 PF00581: Rhodanese" amino acids 119 to 213 (95 residues), 31.1 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 69% identical to Y810_CUPTR: UPF0176 protein RALTA_A0810 (RALTA_A0810) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K07146, UPF0176 protein (inferred from 69% identity to cti:RALTA_A0810)

Predicted SEED Role

"Rhodanese domain protein UPF0176, Betaproteobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JCL9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>ABZR86_RS15830 sulfurtransferase (Dyella japonica UNC79MFTsu3.2)
MPIVNLSAYKFVSLDDLPALRERVLERCLALSLKGTILLAPEGINLFLAGPRDATDAFMA
WLREDARFADLAPKESPSDAVPFGRMRVRLKKEIITMRLPVRPENGRAPAVAPATLRRWL
AQGRDDEGRELVLLDTRNDYETDVGLFEQAVDYRIANFTAFPQAVAADRARFEGRTVVSY
CTGGIRCEKAALHMQDLGIEHVFQLEGGILKYFEETDGAYWRGDCFVFDGRGAVDKALAP
SALDSDGADA