Protein Info for ABZR86_RS15780 in Dyella japonica UNC79MFTsu3.2

Annotation: pyridoxal-phosphate dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 20 to 305 (286 residues), 251.9 bits, E=4.5e-79

Best Hits

Swiss-Prot: 48% identical to SRR_DICDI: Probable serine racemase (srr) from Dictyostelium discoideum

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 66% identity to smt:Smal_3833)

MetaCyc: 46% identical to serine racemase/D-serine ammonia-lyase (Arabidopsis thaliana col)
Amino-acid racemase. [EC: 5.1.1.10, 5.1.1.18]; D-serine ammonia-lyase. [EC: 5.1.1.10, 5.1.1.18, 4.3.1.18]

Predicted SEED Role

"Threonine dehydratase, catabolic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Glycine and Serine Utilization or Threonine anaerobic catabolism gene cluster or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• alanine racemization (1/1 steps found)
• serine racemization (1/1 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• L-methionine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• vancomycin resistance II (2/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• L-threonine degradation I (4/6 steps found)
• L-alanine degradation I (1/2 steps found)
• L-threonine degradation V (1/2 steps found)
• glycine betaine degradation I (5/8 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• L-lysine degradation V (2/9 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)
• cyclosporin A biosynthesis (2/15 steps found)
• superpathway of L-lysine degradation (7/43 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• D-Arginine and D-ornithine metabolism
• D-Glutamine and D-glutamate metabolism
• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.18, 4.3.1.19

Use Curated BLAST to search for 4.3.1.18 or 4.3.1.19 or 5.1.1.10 or 5.1.1.18

Sequence Analysis Tools

See A0A1I2JBA4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>ABZR86_RS15780 pyridoxal-phosphate dependent enzyme (Dyella japonica UNC79MFTsu3.2)
MSGLPDLDQIRDAAARIAPYAAVTPVLRSARLDALAGAQLHFKCENLQRGGAFKFRGACN
AVWSLDDAQAARGVVTHSSGNHGNALAMAAATRGIAAHVVVPEGAVRAKLEAIEQAGAVL
HRCAPTTAAREAMTAELQRQTGAELVHPYADARVMAGQGTLVLELMRQVEGLDALITPVG
GGGLAAGCAIAAHGLKPELAMYGAEPTGADDAARSLAQGARVEPFQADTLCDGLRTLIGA
PNFDALRTHRTQVITVSDEETIAAMKLLWRELKLVVEVSSATVLAAVLKQAEHFAGRRVG
LVLTGGNVDLDALPW