Protein Info for ABZR86_RS15720 in Dyella japonica UNC79MFTsu3.2

Annotation: GspE/PulE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF05157: MshEN" amino acids 75 to 175 (101 residues), 67.6 bits, see alignment E=1e-22 PF00437: T2SSE" amino acids 222 to 487 (266 residues), 305.2 bits, see alignment E=3.4e-95

Best Hits

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 65% identity to xcb:XC_4179)

Predicted SEED Role

"Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J9D9 at UniProt or InterPro

Protein Sequence (606 amino acids)

>ABZR86_RS15720 GspE/PulE family protein (Dyella japonica UNC79MFTsu3.2)
MAASPQIASLLGRRGKLTLDDVLAALVVDGFVQAEDAKNVRMGNRSGRSSVELHPLVLIA
NAKLANQRDPGRPLSLEVLTEWLATHAGLPYLKIDPMKINVAAVTQVVSSAYATRHRILP
VAASPGEVTFATCEPFDPSWAADLSHMIRRDVKRVVSNPLDINRYLLEFYGVQRSIQLAQ
DAKTSGYDSSAILNFEQLVELGKSGEVGADDRHVVHIVDWLLQYAFEQRASDIHLEPRRE
AGLMRFRIDGVMHKVFELPPPVMTAVTARIKILSRMDVAEKRRPQDGRIKTRSSGGREVE
LRISTMPTAFGEKVVMRIFDPDIVAKDFSQLGFSAEEGALWRSMVERPHGIVLVTGPTGS
GKTTTLYSTLKHLATPELNVCTVEDPIEMVSPELNQMQVQTSIDLDFAAGVRTLLRQDPD
IIMVGEIRDLETAQMAVQASLTGHLVLSTLHTNDAPSAVTRLLDLGVPHYLIQSTLTGVV
AQRLVRTLCPHCKQATEQEPHEWTALTHGWSVPLPETVFKPVGCLECRNTGFMGRTGIYE
MMILSPRLRGLLSSQLDLGRFGTAALAEGMRPLRISAAAQVARGLTTVKEVLTVLPPIEL
PEGHSH