Protein Info for ABZR86_RS15655 in Dyella japonica UNC79MFTsu3.2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 310 to 334 (25 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF07690: MFS_1" amino acids 1 to 224 (224 residues), 51.5 bits, see alignment E=1.1e-17 amino acids 231 to 405 (175 residues), 36.1 bits, see alignment E=5.7e-13 PF13000: Acatn" amino acids 4 to 83 (80 residues), 26.7 bits, see alignment E=3.1e-10 PF00083: Sugar_tr" amino acids 60 to 174 (115 residues), 23.5 bits, see alignment E=3.6e-09

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 52% identity to gpb:HDN1F_28080)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GSE0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>ABZR86_RS15655 MFS transporter (Dyella japonica UNC79MFTsu3.2)
MCLLGFSSGLPFLLVAGTLAYWLKERGVELKEITMIASAGMFYAFKFVWAPLLDHWKLPL
FRRLGQRRGWLLFSQLVVAGGLLAMAALTPAALGPFIVATLVVAFFGATQDIAVDAYRIE
IASVEAQGALVATYALGYRIGLLAAGALALILADHVSWSWVYVAMALGMSLPILTTLLAR
EPEVIRQAPRNWGEAMREAVIDPFTDFFRRYGWLLAGVTLAFILLFKIPEQATIGGVMSP
FYRDMGFSKTEIGTITKIYGIWIGIVGVFIGGAAVARWGAWRTLGATIVLCGASNLLYLL
VIMYPGNLLVLTLVISGENLTLGILGPPTVAFLSSLVNRQHTATQYALLSSLVNLPGKLL
GFFAGGIATATGYGTYFVITVIAVLPATALFLYLWPHYRAEERARGAG