Protein Info for ABZR86_RS15630 in Dyella japonica UNC79MFTsu3.2

Annotation: phosphomannomutase/phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 326 to 456 (131 residues), 129.2 bits, E=1.8e-41
• PF02879: PGM_PMM_II
  • amino acids 472 to 569 (98 residues), 101.9 bits, E=5.4e-33
• PF02880: PGM_PMM_III
  • amino acids 574 to 680 (107 residues), 72.2 bits, E=7.7e-24
• PF00408: PGM_PMM_IV
  • amino acids 693 to 768 (76 residues), 43.7 bits, E=4.6e-15

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucomutase (EC 5.4.2.2)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.2, EC 5.4.2.8)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (17/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glycogen degradation II (3/6 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• glycogen degradation I (3/8 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (6/14 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2 or 5.4.2.8

Sequence Analysis Tools

See A0A1I2GN03 at UniProt or InterPro

Protein Sequence (779 amino acids)

>ABZR86_RS15630 phosphomannomutase/phosphoglucomutase (Dyella japonica UNC79MFTsu3.2)
MAMDIAMGLRERTFDWQRLLPLAGGTLLLVGGLFCAWQSWLIADESAAIERVHRAQDQLA
QSLADELASQRRTLQQQLDTLDPAAVQADPKYAATLLRGKVPQAQAIEFYSGTLDEVLHA
NYRDFGYAKAAQLMAAQTADGDTLAQTLPKGVGDRRLSFVLPMGPRQHPNAWVLFELPFA
PVEERFNAVPPEGGRLELRQGDDRGRGDARLLANGNGSALSEPVGKVVAGSNLSVVAAPP
GAYIVLPKSVLLAALLTLLGLGGGVYLLWMRGRVPGVSFGRPKISNEEPILSDLIDNTPE
PAKPEARPAKPAAPAAPVPVTVDPTIFRAYDVRGIVGKSLNTDVARLLGQSIGTVMREKG
LREIVVGRDGRLSGPELTAALSDGLREAGIDVIDIGAVPTPVVYYAAYRFNTGSGVAVTG
SHNPPDYNGFKIVVGGETLSEGSIQDLYRRIAANELERGGKGSLRQIDVVPDYVERITSD
VQAGRRMKVVVDCGNGIPGSVAPQVLEGIGCEVIQLYCDVDGTFPNHHPDPSDPHNLEDL
ILAVKSTGADLGVAFDGDGDRLGVVTKTGEIIFPDRTLMLFARDVLSRQPGATIIYDVKC
TGHLKGQILDAGGSPLMWRTGHSLIKSKMRETGAELAGEMSGHFFFKERWYGFDDGIYAG
ARLLEILAGDLDERTPEQIFATCPKGVSTPELKIEMKEGEHYKFIEKFRQSASFGDAALT
TIDGVRADWPDGWGLVRPSNTTPILVLRFDADNDAALKRIQNVFREQLHAVDPALKLPF