Protein Info for ABZR86_RS15585 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 8 to 262 (255 residues), 326.4 bits, see alignment E=5.4e-102 PF00106: adh_short" amino acids 8 to 200 (193 residues), 179.3 bits, see alignment E=9.3e-57 PF08659: KR" amino acids 10 to 176 (167 residues), 36.2 bits, see alignment E=9e-13 PF13561: adh_short_C2" amino acids 14 to 259 (246 residues), 161.8 bits, see alignment E=3.2e-51

Best Hits

Swiss-Prot: 35% identical to YXJF_BACSU: Uncharacterized oxidoreductase YxjF (yxjF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 78% identity to axy:AXYL_06209)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GNC1 at UniProt or InterPro

Protein Sequence (262 amino acids)

>ABZR86_RS15585 3-hydroxybutyrate dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MAASLEGKVALITGAASGLGKAIAELYAKNGCAVAIADINQQAADAAAAEIKAAGGKAIG
IAMDVTDEAAVNAGTDKAVAEFGALDILISNAGVQIINPIDQFAFADWKKMLAIHLDGGF
LTTKAALQHMYKGDRGGTVIYMGSVHSHEASKLKSAYVTAKHGLLGLARTLAKEGAAHNV
RSHVICPGFVRTPLVEKQIPEQAKELGISEAEVIKNVMLKDTVDGTFTTVEDIAETALFL
AAFPSAALTGQSIVVSHGWYMQ