Protein Info for ABZR86_RS15525 in Dyella japonica UNC79MFTsu3.2

Annotation: GGDEF and EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 823 PF00989: PAS" amino acids 22 to 127 (106 residues), 26 bits, see alignment E=3.2e-09 amino acids 146 to 254 (109 residues), 38.8 bits, see alignment E=3.4e-13 amino acids 274 to 385 (112 residues), 34.3 bits, see alignment E=8.4e-12 TIGR00229: PAS domain S-box protein" amino acids 24 to 137 (114 residues), 38.3 bits, see alignment E=1.3e-13 amino acids 138 to 264 (127 residues), 85.6 bits, see alignment E=3.1e-28 amino acids 275 to 387 (113 residues), 38.1 bits, see alignment E=1.5e-13 PF08448: PAS_4" amino acids 27 to 132 (106 residues), 62.4 bits, see alignment E=1.8e-20 amino acids 155 to 258 (104 residues), 30 bits, see alignment E=2.1e-10 amino acids 275 to 389 (115 residues), 37.4 bits, see alignment E=1.1e-12 PF13426: PAS_9" amino acids 34 to 129 (96 residues), 27.5 bits, see alignment E=1.3e-09 amino acids 154 to 256 (103 residues), 46 bits, see alignment E=2.3e-15 amino acids 280 to 386 (107 residues), 29.1 bits, see alignment E=4e-10 PF08447: PAS_3" amino acids 166 to 247 (82 residues), 42.8 bits, see alignment E=2e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 396 to 559 (164 residues), 130.9 bits, see alignment E=3.7e-42 PF00990: GGDEF" amino acids 399 to 555 (157 residues), 154.5 bits, see alignment E=8.4e-49 PF00563: EAL" amino acids 576 to 810 (235 residues), 252.1 bits, see alignment E=2e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GLB0 at UniProt or InterPro

Protein Sequence (823 amino acids)

>ABZR86_RS15525 GGDEF and EAL domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MQRIEPDRQTGPASTEPDWTARVVHGAPALIAYIDRELRIRFANAAHQSWLGVDPAQLLG
RHVSEVLDEASLQRASPCLDEALRGHPSVYEGEMFAGQSRCYVHGSFQPDYDADGTVTGV
FTVLIDITERHALETRLRESEQRFFGAFQHAAIGMGLVAPDGRLLRVNAALCHMLGYREP
ELLQLNIRDITHPDDVAKSFELATELMDGKRDSYQLEKRYFHHDGHVVHVLLTVSLVRAP
DGTPFHAVAQIQDISQRKAYEEALFRERELAEVTLRSIGDAVITTDLQLRVTSLNPIAEA
MTGWSHAEALGQPIEDVFRLIDGDSDELLRNPLREAIGRDTIVELRGNAMLVHRNGFRTP
IEDSAASIHDHAGNVIGGVLVFHDVSATRALVLKMAHMAQHDTLTGLPNRHLLQARLAQV
IAAARRRHGRAALIFINLDHFKHINDSLGHQTGDQLLRLFAAHLRGLLGGEHIVSRTAGD
EFMVVLPHVDSAVDAAKTCELLMRRWHEHPPHELAELALSFSAGISLYPDDADDAEALIR
HADTAMYEAKMQGRNSYRLFTAAMTERPAAQMRIERDLRTAMRRGDLQLHYQPKVDALTG
VVVGAEALLRWQVDGHDVYRPDQFVPVAEESGLIGPLGRWALQQACQQAAVWHRSGRSVS
IAVNVAPPQFLQPGFHDALRDMLRESELPPGMIELELTERMVMSGGDHSRALMQQLKELG
VSLALDDFGTGYSSLSYLKHFPIDVLKIPRAFVRDVATDTDSAAIADAIITMAQSLEMSV
VAEGVETPEQADYLRQAGCRLLQGFLYGAPMPAVEFERLLVPA