Protein Info for ABZR86_RS15510 in Dyella japonica UNC79MFTsu3.2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00512: HisKA" amino acids 121 to 173 (53 residues), 40.4 bits, see alignment 2.5e-14 PF02518: HATPase_c" amino acids 219 to 331 (113 residues), 75.4 bits, see alignment E=4.8e-25

Best Hits

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GPP7 at UniProt or InterPro

Protein Sequence (335 amino acids)

>ABZR86_RS15510 ATP-binding protein (Dyella japonica UNC79MFTsu3.2)
MNTASWRGWAEQMSTGLALVDAGLRVVWINPALAEWLDTGPRSAVGQPLGLLLHEPDWLG
QAERALAEQRAVQLRGVALRTARGREWPADVALQPVDGGVLLEVHVLAPAAPAASPLSAT
LRGFAHEVKNPLAGLRGAAQLLQRRVADEDLKALAGLVIAEADRLASLANRLLHHDGAPR
LGPVNIHEQLEWLTDLLQAEPEPPQLRHDYDPSLPDVKGDAERLQQILLNLARNAIEAGA
RTLTLRTRVEHGLRVGERMLRTALRVDVADDGPGVPAALRDTLFEPLVSGRADGSGLGLA
LAREIAREHGGELRYASRPGETVFSLYLPLERTHE