Protein Info for ABZR86_RS15360 in Dyella japonica UNC79MFTsu3.2

Annotation: YbhB/YbcL family Raf kinase inhibitor-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF01161: PBP" amino acids 30 to 199 (170 residues), 132 bits, see alignment E=9.2e-43 TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 77 to 199 (123 residues), 79.4 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: K06910, (no description) (inferred from 55% identity to bpe:BP2953)

Predicted SEED Role

"Phospholipid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GLM8 at UniProt or InterPro

Protein Sequence (209 amino acids)

>ABZR86_RS15360 YbhB/YbcL family Raf kinase inhibitor-like protein (Dyella japonica UNC79MFTsu3.2)
MQLRSDSFQNGQPVPARCAFGKPGDPVALSDNLSPHLAWKDAPPATRSYVLTCIDSDVPS
RGDDVNQGDRVVPADLPRVEFVHWLMADIPVEYTELAEGACSDGIVAHGKRAPSGPPGSV
QGKNDYTGWFHGDKDMGGEYLGYDGPCPPWNDERVHHYHFRVHALDVEKLNLADGFTLDE
LRKVMHGHVLAQAEIVGTYAIYGKAVVRA