Protein Info for ABZR86_RS15155 in Dyella japonica UNC79MFTsu3.2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13432: TPR_16" amino acids 60 to 122 (63 residues), 21.4 bits, see alignment E=1.1e-07 amino acids 211 to 265 (55 residues), 17.8 bits, see alignment 1.4e-06 amino acids 353 to 413 (61 residues), 22.6 bits, see alignment E=4.5e-08 PF12895: ANAPC3" amino acids 108 to 192 (85 residues), 29.7 bits, see alignment E=2.3e-10

Best Hits

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GJ52 at UniProt or InterPro

Protein Sequence (429 amino acids)

>ABZR86_RS15155 tetratricopeptide repeat protein (Dyella japonica UNC79MFTsu3.2)
MKHVPLIKMLAGAALALTLASSPVIAKDSNSKEKKEALYPNATRTEPKLDLTSEKDQKAL
NEGLDAVNSQDKAKAEQILQPIIDSSKSKYAQALALQGLANLHYNDQDVKGAIGLLKRAL
DIGVMPNDTYFQLQYMLAQFYLADEQYQPAIDTIEKWRTDGKKETAESYALEGNAYYRLE
KYPQAIAAIKKAQSLTDKPNDSWNQILMASYAESGQGDQAAQLAQQQLAANPNDSTALNN
AVAVLMQSQKYPEAIQLMEKSKAAGAFKSEKDYVNLAKLYLVTGQDSSDPKPNAAKAVAT
LNEGMSKGVVTDSYDNLKLLGDSSYVADKPADAISAYKKAMGKASDGEAAIRAGQLLISE
GKNAEAKTLIQQGIDKGVQHKGTAYMLLAEACRGLKDKQGAIAAMQKAAQDPQTADKAKA
WLKTAGAGK