Protein Info for ABZR86_RS15135 in Dyella japonica UNC79MFTsu3.2

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF11638: DnaA_N" amino acids 3 to 63 (61 residues), 43 bits, see alignment E=7.7e-15 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 5 to 448 (444 residues), 558.1 bits, see alignment E=7.8e-172 PF00308: Bac_DnaA" amino acids 116 to 332 (217 residues), 300.4 bits, see alignment E=2.3e-93 PF00004: AAA" amino acids 152 to 269 (118 residues), 24.7 bits, see alignment E=6.8e-09 PF01695: IstB_IS21" amino acids 152 to 253 (102 residues), 26.7 bits, see alignment E=9.8e-10 PF08299: Bac_DnaA_C" amino acids 362 to 428 (67 residues), 100.9 bits, see alignment E=8.4e-33

Best Hits

Swiss-Prot: 67% identical to DNAA_XANC5: Chromosomal replication initiator protein DnaA (dnaA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 67% identity to psu:Psesu_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GJA6 at UniProt or InterPro

Protein Sequence (451 amino acids)

>ABZR86_RS15135 chromosomal replication initiator protein DnaA (Dyella japonica UNC79MFTsu3.2)
MSDLWRRCLERLEGELSAEDLHTWLMPLQARDDTMGLQLFAPNPYTLDTVRERYLPRIEA
MLTQLTGHELSVRLEVGSSAARVPPRPASAMARPAPAPAVAEPTPIQPPAPFNHNLDPHY
TFETFVEGKSNQLGKAAAMQVAMNPGRAYNPLLLYGGTGLGKTHLMHAAGNLMRERNPDF
KVLYLRSEQFVGAMIEALRTKSMDEFKRRFRSVDALLIDDIQFFAGKDTTQEEFFHTFNA
LFESKQQIILTCDRYPKEVDKLEPRLKSRLGWGLSVAIEPPDFETRAAILLAKAHEKDVA
VSENVAMLLAKRIRSNVRDLEGALNTLAARANFYGKPITTEFAEETLRDLLATHAQAVTV
PNIQKTVADYYQVRLQDLLSKRRVRSLARPRQFAMALSKELTEHSLPEIGEAFGGRDHTT
VLHACRTIKKLCETDTRMRQDWEQLIRILTG