Protein Info for ABZR86_RS15125 in Dyella japonica UNC79MFTsu3.2

Annotation: ribonuclease P protein component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00825: Ribonuclease_P
  • amino acids 5 to 111 (107 residues), 96.2 bits, E=6.1e-32
• TIGR00188: ribonuclease P protein component
  • amino acids 9 to 111 (103 residues), 71.3 bits, E=3.6e-24

Best Hits

Swiss-Prot: 41% identical to RNPA_THISH: Ribonuclease P protein component (rnpA) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 43% identity to alv:Alvin_3125)

MetaCyc: 36% identical to RNase P protein component (Escherichia coli K-12 substr. MG1655)
Ribonuclease P. [EC: 3.1.26.5]; 3.1.26.5 [EC: 3.1.26.5]

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

• tRNA processing (10/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

See A0A1I2GH14 at UniProt or InterPro

Protein Sequence (131 amino acids)

>ABZR86_RS15125 ribonuclease P protein component (Dyella japonica UNC79MFTsu3.2)
MRVGLPRESRIRRAGDFAAMRNASGRLGGRCFSVRYRDNELGQARLGLAISKRVSKRAVE
RNRIKRLVRESFRRIRAQLPAVDLLVMAREQASGLPGPELLAEIDYLWKKLLSQKRPPAL
KPDDAAGTIAR