Protein Info for ABZR86_RS15025 in Dyella japonica UNC79MFTsu3.2
Annotation: tyrosine recombinase XerC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 65% identical to XERC_XANC8: Tyrosine recombinase XerC (xerC) from Xanthomonas campestris pv. campestris (strain 8004)
KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 65% identity to xcb:XC_0664)Predicted SEED Role
"Tyrosine recombinase XerC"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2K0T4 at UniProt or InterPro
Protein Sequence (295 amino acids)
>ABZR86_RS15025 tyrosine recombinase XerC (Dyella japonica UNC79MFTsu3.2) MDPRGQVQAWLARLAGERKASPHTVDGYRRDLDKLLRWMEAQQIDAFSRLDAHRMRGFVA AEHRAGLSPKSLQRLLSSCRSLFRQLRREGLLDNDPVAGVRGPKVHRKLPQVLDVDEATT LVESGGDGALGVRDRAMLELFYSSGLRLSELVGLRWLDLDLTQGEVRVLGKGSKTRIVPV GRHAVEALRALGEAEGKAPETPVFRGRGGAPISPRTVQARLKQLALAQGFAKHVHPHLLR HTFASHMLESSGDLRAVQELLGHADIATTQIYTHLDFQHLAKVYDAAHPRAKRKG