Protein Info for ABZR86_RS15025 in Dyella japonica UNC79MFTsu3.2

Annotation: tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF02899: Phage_int_SAM_1" amino acids 7 to 90 (84 residues), 68 bits, see alignment E=7.1e-23 TIGR02224: tyrosine recombinase XerC" amino acids 9 to 293 (285 residues), 343.8 bits, see alignment E=4.5e-107 PF00589: Phage_integrase" amino acids 112 to 279 (168 residues), 158.6 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 65% identical to XERC_XANC8: Tyrosine recombinase XerC (xerC) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 65% identity to xcb:XC_0664)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2K0T4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>ABZR86_RS15025 tyrosine recombinase XerC (Dyella japonica UNC79MFTsu3.2)
MDPRGQVQAWLARLAGERKASPHTVDGYRRDLDKLLRWMEAQQIDAFSRLDAHRMRGFVA
AEHRAGLSPKSLQRLLSSCRSLFRQLRREGLLDNDPVAGVRGPKVHRKLPQVLDVDEATT
LVESGGDGALGVRDRAMLELFYSSGLRLSELVGLRWLDLDLTQGEVRVLGKGSKTRIVPV
GRHAVEALRALGEAEGKAPETPVFRGRGGAPISPRTVQARLKQLALAQGFAKHVHPHLLR
HTFASHMLESSGDLRAVQELLGHADIATTQIYTHLDFQHLAKVYDAAHPRAKRKG