Protein Info for ABZR86_RS14985 in Dyella japonica UNC79MFTsu3.2

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00507: shikimate dehydrogenase" amino acids 6 to 273 (268 residues), 232.6 bits, see alignment E=2.3e-73 PF08501: Shikimate_dh_N" amino acids 8 to 90 (83 residues), 80.6 bits, see alignment E=1.2e-26 PF01488: Shikimate_DH" amino acids 114 to 195 (82 residues), 41.2 bits, see alignment E=2.6e-14 PF18317: SDH_C" amino acids 242 to 272 (31 residues), 33.8 bits, see alignment 3.4e-12

Best Hits

Swiss-Prot: 57% identical to AROE_XYLFM: Shikimate dehydrogenase (NADP(+)) (aroE) from Xylella fastidiosa (strain M12)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 57% identity to xfm:Xfasm12_1685)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2INY9 at UniProt or InterPro

Protein Sequence (276 amino acids)

>ABZR86_RS14985 shikimate dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MSAAQFAVFGHPIAHSLSPQIHQAFARQFGIALEYRTIDAAPAEFAASVRRFFAAGGRGA
NVTLPHKAAAFELADERSEAAVRVGTANVLTPLPDGRLAAHNTDGAGLVRDLTERHRMDL
RGHDALLLGAGGAARGVAWSLLDAGVRTLTIVNRTPETADALADAIGEPARAHTRYWEDL
DDIGSFDLIINATSAGVLGKPLDLPFGFVGNRATCYDLSYGKAAAGFVAWARAANALYAF
DGLGMLVETAADAFELWHGKRPDTDPVHDALRRQYG