Protein Info for ABZR86_RS14930 in Dyella japonica UNC79MFTsu3.2

Annotation: exodeoxyribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00195: exodeoxyribonuclease III" amino acids 1 to 252 (252 residues), 270.1 bits, see alignment E=2.1e-84 TIGR00633: exodeoxyribonuclease III (xth)" amino acids 1 to 254 (254 residues), 256.5 bits, see alignment E=2.8e-80 PF03372: Exo_endo_phos" amino acids 4 to 246 (243 residues), 112.3 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 35% identical to EX3_HAEIN: Exodeoxyribonuclease III (xthA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01142, exodeoxyribonuclease III [EC: 3.1.11.2] (inferred from 67% identity to tkm:TK90_0007)

Predicted SEED Role

"Exodeoxyribonuclease III (EC 3.1.11.2)" in subsystem DNA repair, bacterial (EC 3.1.11.2)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.2

Use Curated BLAST to search for 3.1.11.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IPM2 at UniProt or InterPro

Protein Sequence (255 amino acids)

>ABZR86_RS14930 exodeoxyribonuclease III (Dyella japonica UNC79MFTsu3.2)
MKIASWNVNSLKVRLPQLTEWAAEAKPDVIALQETKLEDAKFPVDELAAAGYRAVYSGQK
TYNGVAILAREEPADVVTDIPGLDDPQRRILAATVGSVRLVDLYVVNGKAVGDEKYAYKL
DWLAKVRDFLEEEHKRHPHLVVLGDFNIAPDDRDVYDPVAWGEDVLCSPPERDALKAITA
LGLHDSFRLFEQDGGHFSWWDYRQAAFRRNMGLRIDLILVGDALKQAVKAAAIDRTPRRW
ERPSDHTPVTLDLDI