Protein Info for ABZR86_RS14905 in Dyella japonica UNC79MFTsu3.2

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 72 to 95 (24 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 288 (201 residues), 54.4 bits, see alignment E=7.1e-19

Best Hits

Swiss-Prot: 38% identical to LACF_RHIRD: Lactose transport system permease protein LacF (lacF) from Rhizobium radiobacter

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 76% identity to psu:Psesu_1285)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IRJ0 at UniProt or InterPro

Protein Sequence (292 amino acids)

>ABZR86_RS14905 sugar ABC transporter permease (Dyella japonica UNC79MFTsu3.2)
MNPQRAAWLFLAPALLVLGLFFLLPVIAALALSLTDYDLYALADIRDLRFVALGNYWELL
HRPLFWSALGHTLYFVLVGVPLSIVASLGAALLLNSPLARCKPLFRTALFAPVVTTVVAV
AVIWRYLFNTKYGLANYALGGLGIHPVDWLGDPRWAMPTIILFAVWKNFGYNMIIFLAAL
QAIPADLYEAARIDGASPLRQFRHITLPMLGPTLLMVGILTVSGYFQLFAEPFVMTEGGP
LQSTTSVLYLMYEEGFKWWNLGSASAVAFLLFLIMFAVTAVMLRVARRGGEA