Protein Info for ABZR86_RS14885 in Dyella japonica UNC79MFTsu3.2

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00356: LacI" amino acids 4 to 48 (45 residues), 54 bits, see alignment 2.4e-18 PF00532: Peripla_BP_1" amino acids 60 to 325 (266 residues), 81.1 bits, see alignment E=1.9e-26 PF13407: Peripla_BP_4" amino acids 63 to 308 (246 residues), 57 bits, see alignment E=4.4e-19 PF13377: Peripla_BP_3" amino acids 168 to 330 (163 residues), 127.2 bits, see alignment E=1.4e-40

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 60% identity to smt:Smal_2686)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IPP6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>ABZR86_RS14885 LacI family DNA-binding transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MGVTIKDVAREAKVSVASVSRALNGHGGVTAETLERIREVAARLRYIPHGAARSLITRRT
HTIGALLPDLYGEFFSELIRGIDLAARVHGLQLLVSSSHDGSAEAAAALRAMQGRVDGLL
VMSPHADAAFLRQNLPVGLPTVLMNTVLERDDYAALSVDNAGGARLVVEHLLGEGYRRIA
FIQGPVGNHDVAEREQAYRDALAARMPGVPPIVLPGEFDEASGYRAGQRLVAMSPRPDAV
FAANDMMAIGCMAAIREAGLRIPEDIAVAGFDDVPMARYVSPALTTAGVRIAELGKAALD
QLAGQIDGDADAAAPVHVRIPAELMVRASSARNHASKAAASD