Protein Info for ABZR86_RS14870 in Dyella japonica UNC79MFTsu3.2

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF10609: ParA" amino acids 2 to 44 (43 residues), 38.2 bits, see alignment 4e-13 PF13614: AAA_31" amino acids 3 to 177 (175 residues), 210.5 bits, see alignment E=6.4e-66 PF09140: MipZ" amino acids 4 to 155 (152 residues), 48.8 bits, see alignment E=2.1e-16 PF06564: CBP_BcsQ" amino acids 4 to 245 (242 residues), 54.1 bits, see alignment E=6e-18 PF01656: CbiA" amino acids 5 to 228 (224 residues), 107.6 bits, see alignment E=1.5e-34 PF00142: Fer4_NifH" amino acids 10 to 46 (37 residues), 27 bits, see alignment 1.1e-09 PF02374: ArsA_ATPase" amino acids 10 to 134 (125 residues), 28.9 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 59% identical to Y002_PSEPK: Uncharacterized protein PP_0002 (PP_0002) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 68% identity to psu:Psesu_2851)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ITQ7 at UniProt or InterPro

Protein Sequence (285 amino acids)

>ABZR86_RS14870 AAA family ATPase (Dyella japonica UNC79MFTsu3.2)
MARIIAVANQKGGVGKTTTAVNLAAALAAAKRKVLLVDLDPQGNATMASGVDKRVAKPNG
CEVLLDEAPIERAIVTTEAHYDLLPGNGDLTAAELKLMDAIAREMRLKEQLAKIADKYHT
ILIDCPPTLHLLTLNALSAADGLLIPVQCEYFALEGLSSLLDTVKAVRQRLNPHLEIEGL
LRTMYDVRNNLGNEVSAQLTTHFGDKVLRSIIPRNVRLAEAPSHGQPIHLYDRSSRGAIA
YIGLAGEIIRRERGLAAGAAAEAALPPHDDSSAVAIDAAADIHQE