Protein Info for ABZR86_RS14800 in Dyella japonica UNC79MFTsu3.2

Annotation: MASE1 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 221 to 237 (17 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details PF05231: MASE1" amino acids 15 to 285 (271 residues), 64.1 bits, see alignment E=6.4e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ISC4 at UniProt or InterPro

Protein Sequence (525 amino acids)

>ABZR86_RS14800 MASE1 domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MQSRAVENPLLRHGAAALLYALGFVLLRQVSFSYWVLFAGYRLTVLLLVPRRYWPALAVG
ELGPLGYTAWLCMDDFGGTWSAIMMIPPIALAMPIVHVCRERWQLFQSRHHVRISVLLLC
ALVCSLVWTGANLAAVSVSIKPASSPAIDLAARWLVGNYLGVLTVAPLALMIREVWQLTP
AHERWTRLMDSRLFLESALGLLPVLMLLAWIGGGGMGDQARQVARMTMFVPVVFLALRHG
WYGVAIGGTMASTAVVFTMPAAFDPGTMQAEVLIAFTISTMMMFGARISVLNRRDLQERL
DSRQTLALAQRTLFLGELRMRQTAMAIEQVRGSIQQTNNLMLERLRYTVPTAEERQYRLQ
TALNQDQLFRLADNLHPVSWRQRGLPAALREGAVARTLEAAGVGYTCDIEGRGLSQLSPG
IHLVLYRTIGEIAGSLCGERDVSRIHVRLRGGAFDGRRWVVMRIDGHRDETAARSVRWGE
LMQGLATTSTGLEAIRDQVALFEGQVRERQLAYGTRVSLILHNPD