Protein Info for ABZR86_RS14700 in Dyella japonica UNC79MFTsu3.2

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 11 to 486 (476 residues), 600.1 bits, E=1.6e-184
• PF00479: G6PD_N
  • amino acids 14 to 185 (172 residues), 186.4 bits, E=8.1e-59
• PF02781: G6PD_C
  • amino acids 187 to 485 (299 residues), 421.1 bits, E=2.1e-130

Best Hits

Swiss-Prot: 65% identical to G6PD_RHIME: Glucose-6-phosphate 1-dehydrogenase (zwf) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 67% identity to bid:Bind_2867)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• aspartate superpathway (21/25 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• heterolactic fermentation (14/18 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• cytosolic NADPH production (yeast) (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

See A0A1I2IRN9 at UniProt or InterPro

Protein Sequence (489 amino acids)

>ABZR86_RS14700 glucose-6-phosphate dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MTASAPLVDAFDLVIFGGTGDLALRKLLPALFHRFLDGQIPAGSRVVGIAREGLDDDGYR
ANIRKALLEAGGAKDKVDAFLTQVAYRSLDARKDEGWDAFAALIGEQPDHVRVFYLSTSP
ELFVDICNRLGEYDLNRGKSRVVLEKPIGRDLASANQINDAVGRIFDESQTYRIDHYLGK
ETVQNLLALRFGNALFEPLWNAGHIDHVQITVAETLGVGTRGAYYDRAGALRDMVQNHIL
QLLCMVAMEPPSSLSPDAVRDEKLKVLRSLRPIDESNAAQYTVRGQYRAGAAEGQSVPGY
LEELGPGSKSHTETFVALKTEIENWRWAGVPFYLRTGKRLPERVSEIVVVFKSVPHSIFD
ASAGPLTQNRLVLRLQPDEGVKLWLTIKHPGPGGLRLRHVPLDMSFAEAFGVSQPDAYER
LLLDVVRGNPTLFMRRDEVEAAWRWAGPILDAWGASGEAPRPYTAGTWGPSAAVALIERD
GRTWNEDSE