Protein Info for ABZR86_RS14570 in Dyella japonica UNC79MFTsu3.2

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 179 (179 residues), 63.8 bits, E=4.4e-21
• PF01370: Epimerase
  • amino acids 3 to 212 (210 residues), 104.5 bits, E=1.8e-33
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 166 (163 residues), 58.6 bits, E=2.3e-19
• PF01073: 3Beta_HSD
  • amino acids 4 to 151 (148 residues), 56.1 bits, E=9.4e-19
• PF02719: Polysacc_synt_2
  • amino acids 40 to 107 (68 residues), 32.5 bits, E=1.6e-11
• PF07993: NAD_binding_4
  • amino acids 52 to 167 (116 residues), 37.2 bits, E=5.8e-13

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 69% identity to ret:RHE_CH03492)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See A0A1I2JMA9 at UniProt or InterPro

Protein Sequence (327 amino acids)

>ABZR86_RS14570 NAD(P)-dependent oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MTILVTGSAGHLGEALMRSLRAASREAIGIDLKASPFTHRTGDIADRAFVRESMRGVHAV
IHTATLHKPHVATHPAQHFVDTNISGTLALLEEAVAAGVRAFVFTSTTSVFGAALTPAAD
APAAWITECVAPVPKNIYGTTKLAAEQLCELYHRRHGLPVLVLRTSRFFPEADDDAAKRA
AYDLANAQANELLYRRADIEDVVNAHLLAIERAPALGFGRYIVSATTPFAPEDLALLHRD
APAVLRRLFPSFEALYGARGWRMFPRIDRVYVNASARHELGWQPRHHFAQVLGCLAAERE
FRSPLALAVGAKGYHATTFGELPYPVD