Protein Info for ABZR86_RS14355 in Dyella japonica UNC79MFTsu3.2

Annotation: serine/threonine-protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 296 to 317 (22 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details PF00069: Pkinase" amino acids 13 to 217 (205 residues), 147.2 bits, see alignment E=1.3e-46 PF07714: PK_Tyr_Ser-Thr" amino acids 16 to 232 (217 residues), 88.2 bits, see alignment E=1.2e-28 PF17203: sCache_3_2" amino acids 333 to 448 (116 residues), 39.1 bits, see alignment E=1.6e-13 PF00672: HAMP" amino acids 486 to 520 (35 residues), 28.3 bits, see alignment (E = 3.7e-10)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JTA4 at UniProt or InterPro

Protein Sequence (567 amino acids)

>ABZR86_RS14355 serine/threonine-protein kinase (Dyella japonica UNC79MFTsu3.2)
MNAVAAPRMIGRYRIDGVLGAGAMAMVYAGFDPGIDRPVAIKCLHRRAAARGLEEHLLAE
ARAAGQLVHPNIVTIFDTGRTEDGRAYVAMERLPGETLASRVAREGLPPLSVVIELATQM
AAALDYAHGQGVLHHDVKPENIMLVDDWHYAKLSDFGIAERRAEGAGDGRIIGGTPAYMA
PERLRGEPSDARSDLFSLGVTLYWLVTGKLPWPDMPDLPRLLRERQRLPHPSIDPIDPAT
PAMLVGIVRTLLSPTPATRYQRGAEVIDDLRLARKEYERAHESPLASRIISLRTRWIGAL
AAILCVVLLAGLAAIYAKQNTAVNGLATDFGGSLGRVVAAEAAENLLLHDDAATRALVQD
VSRNQQIHYLAIANRAGAVVASTAPAELGGVLPTAPASRSALADGVTSYQRRANGADEGM
LLFDVPIRYQDKDVGLLRLGVSTAPLAAAQRTTFWVIAAVLVLTLAAMVGAAYALFRRPL
ALLGMLGEAMLRVARGEYGYRIRLARRDELGRLFATFNLMNSSLQARQPGENPAAPGAAA
DAAAQPTLVLQADDDSEEPAPQANSRS