Protein Info for ABZR86_RS14340 in Dyella japonica UNC79MFTsu3.2

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00356: LacI" amino acids 5 to 49 (45 residues), 65.1 bits, see alignment 7.8e-22 PF13407: Peripla_BP_4" amino acids 75 to 315 (241 residues), 49.1 bits, see alignment E=1.2e-16 PF00532: Peripla_BP_1" amino acids 77 to 312 (236 residues), 87.8 bits, see alignment E=1.9e-28 PF13377: Peripla_BP_3" amino acids 173 to 333 (161 residues), 136.3 bits, see alignment E=2.2e-43

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 55% identity to psu:Psesu_0072)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JTL2 at UniProt or InterPro

Protein Sequence (337 amino acids)

>ABZR86_RS14340 LacI family DNA-binding transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MRVRLEDVARATGVSPKTVSRVLNEEPSVKDSTRKKVLAAMEQMNYRPSPAARGLAGSRS
FLIAMLYDNNENPASTYLAEIQDGVLDACDAHRYSMMVSPLRLRGHDPIRRIDALVADHH
IDGVIMTPPLTDHAPLLRRLQEHGVPYACISPLHRDEAIGVCMDEQQAAKAVVQHLVELG
HKRIGHIVGIANHGASRWRLQGYKDALAAAGLAFDPKLVVQGEFTFGSGVMAARGLFELA
KRPTAIFAANDDMAAGVMWAANERGLKVPRDLSVCGFDDTPLATQLWPPLTTVRQPSREM
GKLATLQLMDKLRGRGTGLLLQVPYTLQLRESTAKPA