Protein Info for ABZR86_RS14270 in Dyella japonica UNC79MFTsu3.2

Annotation: isochorismatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to PHZD2_PSEAE: Phenazine biosynthesis protein PhzD2 (phzD2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 58% identity to pap:PSPA7_3382)

MetaCyc: 53% identical to 2-amino-2-deoxy-isochorismatase (Streptomyces sp. ICC1)
RXN-9030 [EC: 3.3.2.15]

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1) of siderophore biosynthesis" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Iron acquisition in Vibrio or NAD and NADP cofactor biosynthesis global (EC 3.3.2.1)

MetaCyc Pathways

phenazine-1-carboxylate biosynthesis (15/17 steps found)
2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
superpathway of chorismate metabolism (38/59 steps found)
diazepinomicin biosynthesis (2/9 steps found)
vibriobactin biosynthesis (1/9 steps found)
bacillibactin biosynthesis (3/12 steps found)
enterobactin biosynthesis (2/11 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1 or 3.3.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JCE8 at UniProt or InterPro

Protein Sequence (208 amino acids)

>ABZR86_RS14270 isochorismatase family protein (Dyella japonica UNC79MFTsu3.2)
MTGIPAISAYTLPASGQLPRNIPRWTIDPARAVFLIHDMQRYFLRPLREAGLDAPLIDNL
RAIRDYALDHDMQVAYTAQPGGMSRDERGLLRDFWGDGMQVAPEDRAVIEELAPEDRDWV
FKKWRYSAFWRSDLQARMRAHGRDQLVIGGVYAHIGILTTALESFSHDIETFVVADATAD
FSLERHLMALEHAARCCAVVLTTAEIVQ