Protein Info for ABZR86_RS14250 in Dyella japonica UNC79MFTsu3.2

Annotation: PhzF family phenazine biosynthesis isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00654: phenazine biosynthesis protein, PhzF family" amino acids 6 to 276 (271 residues), 189.5 bits, see alignment E=4.3e-60 PF02567: PhzC-PhzF" amino acids 7 to 274 (268 residues), 246 bits, see alignment E=2.8e-77

Best Hits

Swiss-Prot: 61% identical to PHZF_PSEAE: Trans-2,3-dihydro-3-hydroxyanthranilate isomerase (phzF1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 61% identity to pap:PSPA7_3380)

MetaCyc: 60% identical to trans-2,3-dihydro-3-hydroxy-anthranilate isomerase subunit (Pseudomonas fluorescens 2-79)
RXN-9031 [EC: 5.3.3.17]

Predicted SEED Role

"Phenazine biosynthesis protein PhzF" in subsystem Phenazine biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J8E5 at UniProt or InterPro

Protein Sequence (282 amino acids)

>ABZR86_RS14250 PhzF family phenazine biosynthesis isomerase (Dyella japonica UNC79MFTsu3.2)
MPYAVADVFTENPLEGNPVAVFFDAQGLEAQDMQRIARELNLSETTFVFPPPADADVHVR
IFTPVNELPFAGHPTLGTAIVLGQRGHRGTLRMATAMGTIPFELERDREGVVRAASMRQP
VPTWSPYEHAEVLIDGLGLERSTLPVEVYRNGPRHVFVGLPTIAALSAVKPDLRVLATLP
DVAVNCFAGEGRHWRMRMFSPAYGVAEDAATGSAAGPLALHLIRHGLLRFGTGIDILQGV
EMGRPSLMRATVQGSIDAIGPIEVSGSATVVARGELLRWKAQ