Protein Info for ABZR86_RS14210 in Dyella japonica UNC79MFTsu3.2

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF03358: FMN_red" amino acids 1 to 150 (150 residues), 41.9 bits, see alignment E=8.1e-15 PF02525: Flavodoxin_2" amino acids 1 to 199 (199 residues), 180.1 bits, see alignment E=4.4e-57

Best Hits

Swiss-Prot: 58% identical to AZOR7_BURL3: FMN-dependent NADH-azoreductase 7 (azoR7) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 73% identity to bgd:bgla_1g25060)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J9N5 at UniProt or InterPro

Protein Sequence (202 amino acids)

>ABZR86_RS14210 FMN-dependent NADH-azoreductase (Dyella japonica UNC79MFTsu3.2)
MKLLHIDASILGEQSVSRQLTAAIVKQLLAAEPAAEVIHQDLAAEPAGHLSAAEFMAFQG
VEPQDDATRQDAARNAQWLDDFLAADVIVVGAPMYNFSLPTQLRAWLDRLAVAGKSFRYT
ASGAEGLAGGKRVIVASSRGGMYGEGSPMAALDHQETYLRGFFGFLGITDVSFIRAEGLA
FGPESRSAAIDAAVADVAKLAA