Protein Info for ABZR86_RS13925 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 126 to 156 (31 residues), see Phobius details amino acids 170 to 196 (27 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 395 to 412 (18 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details PF13231: PMT_2" amino acids 68 to 220 (153 residues), 41.9 bits, see alignment E=6.4e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2EE78 at UniProt or InterPro

Protein Sequence (568 amino acids)

>ABZR86_RS13925 glycosyltransferase family 39 protein (Dyella japonica UNC79MFTsu3.2)
MPSSAYSRSEHLRSLWPWLPLWTAVALLAIFSHGPMPLYSTRTLAVAWEMWSHGHWLVPH
INGQPYSDKVPLLFWMIHAGWFVFGVNDVWPRVLEVIFGGVELMLLATLARRLFPNRPWV
AKGAPWMLLALAYAFLFGLQVMYEVLLAVWVLAALLTLTPKAHREEPRWLLFGLFIGAGL
MTKGPVMLLHVAFPWLLGPLWNDWANRHRARWYGRGALAVLLGGAILLAWALPAGFSGGD
EYRHRLFFTQTAGRVVDAFDHARPFWWYLTMIPALLFPFSGWPRAWVALGALRRPLEPGL
VFGLCWLLPVLLAFSLISGKQLYYPLPEFAGAALLLAGAIAVLREQKPKLANTAWLGTWP
LGVGGILFAVFLFVLPNLVEHNLMHGEFIDSTSQYSRFFSVVFVVLGALLLLRGRGELRR
LAVAGLIGTLALNTLFTLTMWSNFDLRPAAHLLGAADAEGRAIGYVGNYEGQFHFEGRLS
RPIERLSEGESIQAFARLHPNGLIITRPEKLADSDLRYPLLVQPFRSSWVVIWPAASLAA
QRAGHTPAEPPHPTRLYQIDPWRYRALQ